PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D12G1140
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 271aa    MW: 30988.1 Da    PI: 8.4818
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D12G1140genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+ Ed llv++++ +G g+W++ +++ g+ R++k+c++rw +yl
      Gh_D12G1140 14 RGPWTPREDTLLVKYIQAHGEGHWRSLPKKAGLLRCGKSCRLRWMNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding537.9e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T++E++l+++++ +lG++ W++Ia +++ gRt++++k++w+++l
      Gh_D12G1140  67 RGNITPDEEDLIIRLHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 112
                      7999******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.565961IPR017930Myb domain
SuperFamilySSF466893.63E-3011108IPR009057Homeodomain-like
SMARTSM007175.0E-131363IPR001005SANT/Myb domain
PfamPF002494.7E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-231568IPR009057Homeodomain-like
CDDcd001671.79E-101661No hitNo description
PROSITE profilePS5129426.30262116IPR017930Myb domain
SMARTSM007173.7E-1666114IPR001005SANT/Myb domain
PfamPF002492.3E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-2669116IPR009057Homeodomain-like
CDDcd001674.50E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MGRAPCCSKV GLHRGPWTPR EDTLLVKYIQ AHGEGHWRSL PKKAGLLRCG KSCRLRWMNY  60
LRPDIKRGNI TPDEEDLIIR LHSLLGNRWS LIAGRLPGRT DNEIKNYWNT HLSKRLLSQG  120
TDPTTHKKLP PDNPVVVLVP KKKRKNKSTK PTEQEKPKIH LPKPIRFTSS VCTTKSSSQG  180
GENGQVLVPW SKYINDDENR TGFLCYNDDH DLINSSDFEC QSHHDHDHDH VLGAEGDSND  240
SLEKIYEEYL QLLKTNEDQV QLDSFAESLL I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139146PKKKRKNK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU3243461e-114GU324346.1 Theobroma cacao cultivar Scavina 6 TT2 like MYB transcriptoin factor (MYBPA) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012437779.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLA0A0D2PTV90.0A0A0D2PTV9_G
STRINGPOPTR_0014s09630.11e-110(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.14e-70myb domain protein 5